Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-2 (TVB72), Biotinylated

This Recombinant Human T cell receptor beta variable 7-2 (TVB72), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-2 TRBV7-2

UniProt

A0A1B0GXF2

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGLEFLIYFQGNSAPDKSGLPSDRFSAERTGGSVSTLTIQRTQQEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MVD (NM_002461) Human Recombinant Protein
TP300451L 1 mg

MVD (NM_002461) Human Recombinant Protein

Sign In for Pricing
View Details
Anti-Human IL1B/IL1F2 Antibody (SAA0369), APC
HF943237-01 1 Each

Anti-Human IL1B/IL1F2 Antibody (SAA0369), APC

Sign In for Pricing
View Details
Anti-Human IL1B/IL1F2 Antibody (SAA0369), APC
HF943237-02 100 Tests

Anti-Human IL1B/IL1F2 Antibody (SAA0369), APC

Sign In for Pricing
View Details
LCE3A (NM_178431) Human Over-expression Lysate
LH15595V 100 µg

LCE3A (NM_178431) Human Over-expression Lysate

Sign In for Pricing
View Details
Tead1 (BC060138) Mouse Tagged ORF Clone
MG206462 10 µg

Tead1 (BC060138) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
MESTP2 3'UTR Lenti-reporter-Luc Vector
28376081 1.0 µg

MESTP2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details