Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tripartite motif-containing protein 51G (TR51G), Biotinylated

This Recombinant Human Tripartite motif-containing protein 51G (TR51G), Biotinylated spans the amino acid sequence from region 1-452. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tripartite motif-containing protein 51G TRIM51G TRIM51GP

UniProt

A0A3B3IT33

Expression Region

1-452

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNSGILQVFQRELICPICMNYFIDPVTIDCGHSFCRPCFYLNWQDMAVLAQCSKCKKTTRQRNLKTNICLKNMASIARKASLRQFLSSEEQICGTHRETKEMFCEVDKSLLCLLCSNSQEHRNHRHCPTEWAAEERREELLRKMQSLWRKMCENHRNLNMATNRIRCWKDYVSLRIEAIRAEYHKMVAFFHEEEQRHLERLQKEGEDIFQQLNESKARMEHSRELLRGMYEDLRQMCHKAVVELFQSFGDILQRYESLLLQVSEPVNPEFSAGPIIGLMDRLKGFRVYLTLQHARASSHIFLHGDLRSMKVGCDPQHDPNITDKSECFLQWGADFFISGKFYWEFNMGHSWNWAFGVCNNYWKEKRQNDMIDGEVGLFLLGCVKEDTHCSLFTTSPLVMQYVPRPTDTVGLFLDCEGRTVSFVDVDRSSLIYTIPNCSFSPPLWPIICCSHF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPLC Reservoir, Conical Bottom
1220060 1 Unit

HPLC Reservoir, Conical Bottom

Sign In for Pricing
View Details
Factor XIIIa Rabbit Monoclonal Antibody
orb2989750-01 30 µL

Factor XIIIa Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Factor XIIIa Rabbit Monoclonal Antibody
orb2989750-02 50 µL

Factor XIIIa Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Factor XIIIa Rabbit Monoclonal Antibody
orb2989750-03 100 µL

Factor XIIIa Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Factor XIIIa Rabbit Monoclonal Antibody
orb2989750-04 200 µL

Factor XIIIa Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PEX16 Rabbit Polyclonal Antibody (HRP)
orb3003083 100 µg

PEX16 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details