Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 4-2 (TVB42), Biotinylated

This Recombinant Human T cell receptor beta variable 4-2 (TVB42), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 4-2 TRBV4-2 TCRBV7S3A2 TCRBV7S3A2T

UniProt

A0A539

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQSAKKPLELMFVYNFKEQTENNSVPSRFSPECPNSSHLFLHLHTLQPEDSALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Telotristat Ethyl
TRC-T017098-5MG 5 mg

Telotristat Ethyl

Sign In for Pricing
View Details
Piribedil
TRC-P508750-1G 1 g

Piribedil

Sign In for Pricing
View Details
NDRG2 (NM_201535) Human Recombinant Protein
TP319812L 1 mg

NDRG2 (NM_201535) Human Recombinant Protein

Sign In for Pricing
View Details
Coumarin
TRC-C755380-50MG 50 mg

Coumarin

Sign In for Pricing
View Details
NRP2 (NM_003872) Human Over-expression Lysate
LY401275 100 µg

NRP2 (NM_003872) Human Over-expression Lysate

Sign In for Pricing
View Details
Melanoma Marker (HMB45 + A103 + T311), CF740 conjugate, 0.1mg/mL
BNC740702-500 1x 500 µL

Melanoma Marker (HMB45 + A103 + T311), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details