Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 4-2 (TVB42), Biotinylated

This Recombinant Human T cell receptor beta variable 4-2 (TVB42), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 4-2 TRBV4-2 TCRBV7S3A2 TCRBV7S3A2T

UniProt

A0A539

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQSAKKPLELMFVYNFKEQTENNSVPSRFSPECPNSSHLFLHLHTLQPEDSALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Testis
CS633308 5x 5 µm

Frozen Tissue Sections, Testis

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse Ly6G Antibody[1A8]
E-AB-F1108Q-01 50 Tests

Elab Fluor® Violet 450 Anti-Mouse Ly6G Antibody[1A8]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse Ly6G Antibody[1A8]
E-AB-F1108Q-02 100 Tests

Elab Fluor® Violet 450 Anti-Mouse Ly6G Antibody[1A8]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse Ly6G Antibody[1A8]
E-AB-F1108Q-03 2x 100 Tests

Elab Fluor® Violet 450 Anti-Mouse Ly6G Antibody[1A8]

Sign In for Pricing
View Details
FAM131C Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6F3]
TA810728BM 100 µL

FAM131C Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6F3]

Sign In for Pricing
View Details
SAV1 Rabbit Polyclonal Antibody
TA366536 100 µL

SAV1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details