Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 4-2 (TVB42), Biotinylated

This Recombinant Human T cell receptor beta variable 4-2 (TVB42), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 4-2 TRBV4-2 TCRBV7S3A2 TCRBV7S3A2T

UniProt

A0A539

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQSAKKPLELMFVYNFKEQTENNSVPSRFSPECPNSSHLFLHLHTLQPEDSALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCHCR1, ID (Coiled-coil alpha-helical Rod Protein 1, Alpha-helical Coiled-coil Rod Protein, Putative Gene 8 Protein, Pg8, HCR, C6orf18) (Biotin)
MBS6466141-01 0.2 mL

CCHCR1, ID (Coiled-coil alpha-helical Rod Protein 1, Alpha-helical Coiled-coil Rod Protein, Putative Gene 8 Protein, Pg8, HCR, C6orf18) (Biotin)

Sign In for Pricing
View Details
CCHCR1, ID (Coiled-coil alpha-helical Rod Protein 1, Alpha-helical Coiled-coil Rod Protein, Putative Gene 8 Protein, Pg8, HCR, C6orf18) (Biotin)
MBS6466141-02 5x 0.2 mL

CCHCR1, ID (Coiled-coil alpha-helical Rod Protein 1, Alpha-helical Coiled-coil Rod Protein, Putative Gene 8 Protein, Pg8, HCR, C6orf18) (Biotin)

Sign In for Pricing
View Details
GENLISA™ Human Fibroblast Growth Factor Receptor 3 (FGFR3) ELISA
KBH5290 1x 96 Well

GENLISA™ Human Fibroblast Growth Factor Receptor 3 (FGFR3) ELISA

Sign In for Pricing
View Details
DDT siRNA (Human)
orb1867094-01 15 nmol

DDT siRNA (Human)

Sign In for Pricing
View Details
DDT siRNA (Human)
orb1867094-02 30 nmol

DDT siRNA (Human)

Sign In for Pricing
View Details
Recombinant Mouse Fms-LikeTyrosine Kinase 3 Ligand/FLT3LG Protein (C-6His)
MBS2553501-01 0.01 mg

Recombinant Mouse Fms-LikeTyrosine Kinase 3 Ligand/FLT3LG Protein (C-6His)

Sign In for Pricing
View Details