Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 4-1 (TVB41), Biotinylated

This Recombinant Human T cell receptor beta variable 4-1 (TVB41), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 4-1 TRBV4-1 TCRBV7S1A1N2T

UniProt

A0A577

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVTQTPKHLVMGMTNKKSLKCEQHMGHRAMYWYKQKAKKPPELMFVYSYEKLSINESVPSRFSPECPNSSLLNLHLHALQPEDSALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

14-3-3 β shRNA (h) Lentiviral Particles
sc-29186-V 200 µL

14-3-3 β shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Nos2 (NM_010927) Mouse Tagged ORF Clone Lentiviral Particle
MR211704L3V 200 µL

Nos2 (NM_010927) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
FRA5C Protein Vector (Human) (pPB-N-His)
PV079194 500 ng

FRA5C Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Human anti-human HER3 mAb
E4A09D16-50 50 µg

Human anti-human HER3 mAb

Sign In for Pricing
View Details
Pomolic acid 28-O-beta-D-glucopyranosyl ester
M31076-01 100 mg

Pomolic acid 28-O-beta-D-glucopyranosyl ester

Sign In for Pricing
View Details
Pomolic acid 28-O-beta-D-glucopyranosyl ester
M31076-02 50 mg

Pomolic acid 28-O-beta-D-glucopyranosyl ester

Sign In for Pricing
View Details