Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-1 (TVB51), Biotinylated

This Recombinant Human T cell receptor beta variable 5-1 (TVB51), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-1 TRBV5-1 TCRBV5S1A1T

UniProt

A0A578

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPRYLIKTRGQQVTLSCSPISGHRSVSWYQQTPGQGLQFLFEYFSETQRNKGNFPGRFSGRQFSNSRSEMNVSTLELGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E2F2 Polyclonal Antibody, Biotin Conjugated
A50940-100 100 µL

E2F2 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
AQP6 Antibody - C-terminal region
OABB01247-100UG 100 µg/Vial

AQP6 Antibody - C-terminal region

Sign In for Pricing
View Details
USP2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV694768 1.0 µg DNA

USP2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Selenophosphate synthetase 1 (SEPHS1) (NM_001195604) Human Over-expression Lysate
E45H00205-2 20 µg

Selenophosphate synthetase 1 (SEPHS1) (NM_001195604) Human Over-expression Lysate

Sign In for Pricing
View Details
Dystrobrevin beta (DTNB) Mouse Monoclonal Antibody [Clone ID: LBI3C11]
AMM12298V 100 µL

Dystrobrevin beta (DTNB) Mouse Monoclonal Antibody [Clone ID: LBI3C11]

Sign In for Pricing
View Details
Sheep CLDN4 (Claudin 4) ValidElisa Kit
EK343792 96 Well

Sheep CLDN4 (Claudin 4) ValidElisa Kit

Sign In for Pricing
View Details