Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-1 (TVB51), Biotinylated

This Recombinant Human T cell receptor beta variable 5-1 (TVB51), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-1 TRBV5-1 TCRBV5S1A1T

UniProt

A0A578

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPRYLIKTRGQQVTLSCSPISGHRSVSWYQQTPGQGLQFLFEYFSETQRNKGNFPGRFSGRQFSNSRSEMNVSTLELGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC27 (NM_001293089) Human Untagged Clone
SC337530 10 µg

CDC27 (NM_001293089) Human Untagged Clone

Sign In for Pricing
View Details
C7orf10 (SUGCT) (NM_024728) Human Tagged ORF Clone
RG224255 10 µg

C7orf10 (SUGCT) (NM_024728) Human Tagged ORF Clone

Sign In for Pricing
View Details
GITR / TNFRSF18 Recombinant Protein
11-473 0.1 mg

GITR / TNFRSF18 Recombinant Protein

Sign In for Pricing
View Details
MKNK1 Antibody
orb127065-01 25 µg

MKNK1 Antibody

Sign In for Pricing
View Details
MKNK1 Antibody
orb127065-02 50 µg

MKNK1 Antibody

Sign In for Pricing
View Details
MKNK1 Antibody
orb127065-03 100 µg

MKNK1 Antibody

Sign In for Pricing
View Details