Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 11-2 (TVBK2), Biotinylated

This Recombinant Human T cell receptor beta variable 11-2 (TVBK2), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 11-2 TRBV11-2 TCRBV21S3A2N2T

UniProt

A0A584

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQILGQGPKLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPAKLEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppp1r9b 3'UTR GFP Stable Cell Line
TU266673 1.0 mL

Ppp1r9b 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-p47 phox/NCF1 Antibody Picoband®, Cy3 Conjugate
A01586-3-Cy3 100 µg/Vial

Anti-p47 phox/NCF1 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
DMXL2 Antibody, HRP conjugated
A61573-100UG 100 µg

DMXL2 Antibody, HRP conjugated

Sign In for Pricing
View Details
Anti-MECOM antibody
STJ27641 100 µl

Anti-MECOM antibody

Sign In for Pricing
View Details
Zfp180 (NM_001271280) Rat Untagged Clone
RN217045 10 µg

Zfp180 (NM_001271280) Rat Untagged Clone

Sign In for Pricing
View Details
OR4F4 Protein Vector (Human) (pPB-C-His)
PV107118 500 ng

OR4F4 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details