Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-5 (TVB55), Biotinylated

This Recombinant Human T cell receptor beta variable 5-5 (TVB55), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-5 TRBV5-5 TCRBV5S3A2T

UniProt

A0A597

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSPISGHKSVSWYQQVLGQGPQFIFQYYEKEERGRGNFPDRFSARQFPNYSSELNVNALLLGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBTB18 Antibody (FITC)
orb357633-01 50 µg

ZBTB18 Antibody (FITC)

Sign In for Pricing
View Details
ZBTB18 Antibody (FITC)
orb357633-02 100 µg

ZBTB18 Antibody (FITC)

Sign In for Pricing
View Details
Muc13 (NM_010739) Mouse Tagged ORF Clone Lentiviral Particle
MR209013L4V 200 µL

Muc13 (NM_010739) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Human NEK6 (N-GST tag)
MBS4160252-01 0.01 mg

Recombinant Human NEK6 (N-GST tag)

Sign In for Pricing
View Details
Recombinant Human NEK6 (N-GST tag)
MBS4160252-02 5x 0.01 mg

Recombinant Human NEK6 (N-GST tag)

Sign In for Pricing
View Details
MAFF Protein Vector (Human) (pPM-C-His)
PV092877 500 ng

MAFF Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details