Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-5 (TVB55), Biotinylated

This Recombinant Human T cell receptor beta variable 5-5 (TVB55), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-5 TRBV5-5 TCRBV5S3A2T

UniProt

A0A597

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSPISGHKSVSWYQQVLGQGPQFIFQYYEKEERGRGNFPDRFSARQFPNYSSELNVNALLLGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plakophilin 3 (PKP3) Mouse Monoclonal Antibody [Clone ID: 23E3/4]
BM6031P 100 µg

Plakophilin 3 (PKP3) Mouse Monoclonal Antibody [Clone ID: 23E3/4]

Sign In for Pricing
View Details
Allantoin pregnenolone acetate
orb1986577-01 100 mg

Allantoin pregnenolone acetate

Sign In for Pricing
View Details
Allantoin pregnenolone acetate
orb1986577-02 50 mg

Allantoin pregnenolone acetate

Sign In for Pricing
View Details
Allantoin pregnenolone acetate
orb1986577-03 25 mg

Allantoin pregnenolone acetate

Sign In for Pricing
View Details
Rabbit Polyclonal Leucyl-cystinyl Aminopeptidase/LNPEP Antibody [Biotin]
NBP2-81854B 0.1 mL

Rabbit Polyclonal Leucyl-cystinyl Aminopeptidase/LNPEP Antibody [Biotin]

Sign In for Pricing
View Details
FCF1 Antibody
orb1258761 100 µL

FCF1 Antibody

Sign In for Pricing
View Details