Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 14 (TVB14), Biotinylated

This Recombinant Human T cell receptor beta variable 14 (TVB14), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 14 TRBV14 TCRBV14S1 TCRBV16S1A1N1

UniProt

A0A5B0

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQFPSHSVIEKGQTVTLRCDPISGHDNLYWYRRVMGKEIKFLLHFVKESKQDESGMPNNRFLAERTGGTYSTLKVQPAELEDSGVYFCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKAB2 Antibody
KC-49138-01 50 μL

PRKAB2 Antibody

Sign In for Pricing
View Details
PRKAB2 Antibody
KC-49138-02 100 µL

PRKAB2 Antibody

Sign In for Pricing
View Details
PRKAB2 Antibody
KC-49138-03 1 mL

PRKAB2 Antibody

Sign In for Pricing
View Details
Human anoctamin 5 (ANO5) activation kit by CRISPRa
GA116454 1 Kit

Human anoctamin 5 (ANO5) activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human IL12RB1 Protein (His Tag)
PKSH031032 100 µg

Recombinant Human IL12RB1 Protein (His Tag)

Sign In for Pricing
View Details
Secretory Component / ECM1 (ECM1/2889R), 0.2mg/mL
BNUB2889-500 1x 500 µL

Secretory Component / ECM1 (ECM1/2889R), 0.2mg/mL

Sign In for Pricing
View Details