Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 14 (TVB14), Biotinylated

This Recombinant Human T cell receptor beta variable 14 (TVB14), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 14 TRBV14 TCRBV14S1 TCRBV16S1A1N1

UniProt

A0A5B0

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQFPSHSVIEKGQTVTLRCDPISGHDNLYWYRRVMGKEIKFLLHFVKESKQDESGMPNNRFLAERTGGTYSTLKVQPAELEDSGVYFCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,3'-((2-Hydroxypropane-1,3-diyl)bis(oxy))bis(4-chlorobenzoic acid) Diethyl Ester
TRC-H952720-100MG 100 mg

3,3'-((2-Hydroxypropane-1,3-diyl)bis(oxy))bis(4-chlorobenzoic acid) Diethyl Ester

Sign In for Pricing
View Details
Isovalerylcarnitine-d9
TRC-I238061-10MG 10 mg

Isovalerylcarnitine-d9

Sign In for Pricing
View Details
Heparan Sulfate (Technical Grade)
TRC-H245780-1MG 1 mg

Heparan Sulfate (Technical Grade)

Sign In for Pricing
View Details
BBOX1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F4]
TA505789AM 100 µL

BBOX1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F4]

Sign In for Pricing
View Details
Human ATG4D activation kit by CRISPRa
GA113811 1 Kit

Human ATG4D activation kit by CRISPRa

Sign In for Pricing
View Details
2-Bromophenol
TRC-B686165-50G 50 g

2-Bromophenol

Sign In for Pricing
View Details