Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 28 (TVB28), Biotinylated

This Recombinant Human T cell receptor beta variable 28 (TVB28), Biotinylated spans the amino acid sequence from region 27-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 28 TRBV28 TCRBV3S1

UniProt

A0A5B6

Expression Region

27-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SRYLVKRTGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLILESASTNQTSMYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPM1E, CT (PP2C-eta, PP2CE, Protein Phosphatase 1M, Protein Phosphatase 2C Isoform eta, PPM1M) (Biotin) discontinued
P9107-19H-Biotin 200 µL

PPM1E, CT (PP2C-eta, PP2CE, Protein Phosphatase 1M, Protein Phosphatase 2C Isoform eta, PPM1M) (Biotin) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal ZNF690 Antibody (ZSCAN29/2610) [FITC]
NBP2-79881F 0.1 mL

Mouse Monoclonal ZNF690 Antibody (ZSCAN29/2610) [FITC]

Sign In for Pricing
View Details
SFRP2 protein (His tag)
80R-3739 0.1 mg

SFRP2 protein (His tag)

Sign In for Pricing
View Details
SLC26A8 Antibody
E40PV3534 50 µL

SLC26A8 Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal Olig2 Antibody (OLIG2/7366R) [Alexa Fluor 488]
NBP3-20891AF488 0.1 mL

Rabbit Monoclonal Olig2 Antibody (OLIG2/7366R) [Alexa Fluor 488]

Sign In for Pricing
View Details
TM9SF2 sgRNA CRISPR Lentivector set (Human)
K2382401 3x 1.0 µg

TM9SF2 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details