Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 29-1 (TVB29), Biotinylated

This Recombinant Human T cell receptor beta variable 29-1 (TVB29), Biotinylated spans the amino acid sequence from region 17-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 29-1 TRBV29-1 TCRBV4S1A1T

UniProt

A0A5B7

Expression Region

17-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AVISQKPSRDICQRGTSLTIQCQVDSQVTMMFWYRQQPGQSLTLIATANQGSEATYESGFVIDKFPISRPNLTFSTLTVSNMSPEDSSIYLCSVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LCP2 Protein Vector (Rat) (pPB-C-His)
PV277246 500 ng

LCP2 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
ERI1 Antibody
A45539-50UG 50 µg

ERI1 Antibody

Sign In for Pricing
View Details
anti-MVK
YF-PA13279 50 ug

anti-MVK

Sign In for Pricing
View Details
Lentiviral human FAM124A shRNA (UAS) - Lentiviral human FAM124A shRNA (UAS, RFP) plasmid
GTR15335596 1 Vial

Lentiviral human FAM124A shRNA (UAS) - Lentiviral human FAM124A shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
GPX4 Recombinant Antibody, Cy5 Conjugated
bsm-61552R-Cy5-TR 20 µL

GPX4 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Sheep Protein Muted homolog (MUTED) ELISA kit
GTR10430010 96 Well

Sheep Protein Muted homolog (MUTED) ELISA kit

Sign In for Pricing
View Details