Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 29-1 (TVB29), Biotinylated

This Recombinant Human T cell receptor beta variable 29-1 (TVB29), Biotinylated spans the amino acid sequence from region 17-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 29-1 TRBV29-1 TCRBV4S1A1T

UniProt

A0A5B7

Expression Region

17-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AVISQKPSRDICQRGTSLTIQCQVDSQVTMMFWYRQQPGQSLTLIATANQGSEATYESGFVIDKFPISRPNLTFSTLTVSNMSPEDSSIYLCSVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-RANBP3 Antibody Picoband® (Dylight488 Conjugate)
A06252-1-Dylight488 100 µg

Anti-RANBP3 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Human OR1L6 Protein Lysate 20ug
IHUOR1L6PLLY20UG 20 µg

Human OR1L6 Protein Lysate 20ug

Sign In for Pricing
View Details
ETV6 Polyclonal Antibody
MBS2575830-01 0.06 mL

ETV6 Polyclonal Antibody

Sign In for Pricing
View Details
ETV6 Polyclonal Antibody
MBS2575830-02 0.12 mL

ETV6 Polyclonal Antibody

Sign In for Pricing
View Details
ETV6 Polyclonal Antibody
MBS2575830-03 0.2 mL

ETV6 Polyclonal Antibody

Sign In for Pricing
View Details
ETV6 Polyclonal Antibody
MBS2575830-04 5x 0.2 mL

ETV6 Polyclonal Antibody

Sign In for Pricing
View Details