Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 38-2/delta variable 8 (TV382), Biotinylated

This Recombinant Human T cell receptor alpha variable 38-2/delta variable 8 (TV382), Biotinylated spans the amino acid sequence from region 22-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 38-2/delta variable 8 TRAV38-2DV8

UniProt

A0JD32

Expression Region

22-116

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTVTQSQPEMSVQEAETVTLSCTYDTSESDYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAYRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clcc1 (NM_145543) Mouse Tagged ORF Clone
MR208623 10 µg

Clcc1 (NM_145543) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse DNA Fragmentation Factor Subunit Beta (DFFB) ELISA Kit
abx514956 96 Well

Mouse DNA Fragmentation Factor Subunit Beta (DFFB) ELISA Kit

Sign In for Pricing
View Details
REEP6 ORF Vector (Human) (pORF)
38790011 1.0 µg DNA

REEP6 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Otol1a Antibody
orb860032 2 mg

Otol1a Antibody

Sign In for Pricing
View Details
WNK1 Polyclonal Antibody, Cy5.5 Conjugated
bs-3604R-Cy5.5 100 µL

WNK1 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Recombinant Mycoplasma hyopneumoniae Guanylate kinase (gmk)
MBS1451229-01 0.02 mg (E-Coli)

Recombinant Mycoplasma hyopneumoniae Guanylate kinase (gmk)

Sign In for Pricing
View Details