Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 38-2/delta variable 8 (TV382), Biotinylated

This Recombinant Human T cell receptor alpha variable 38-2/delta variable 8 (TV382), Biotinylated spans the amino acid sequence from region 22-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 38-2/delta variable 8 TRAV38-2DV8

UniProt

A0JD32

Expression Region

22-116

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTVTQSQPEMSVQEAETVTLSCTYDTSESDYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAYRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp516 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
51007156 3x 1.0 µg DNA

Zfp516 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Erythromycin estolate 100mg
A17671-100 100 mg

Erythromycin estolate 100mg

Sign In for Pricing
View Details
Recombinant Caenorhabditis Elegans sre-30 Protein (aa 1-357)
VAng-Ly3741-inquire Inquire

Recombinant Caenorhabditis Elegans sre-30 Protein (aa 1-357)

Sign In for Pricing
View Details
Mouse monoclonal antibody to Human CD11b (Clone 44)
ab-131-366 500 µg

Mouse monoclonal antibody to Human CD11b (Clone 44)

Sign In for Pricing
View Details
ANLN Rabbit Polyclonal Antibody
E10G07847 100 µL

ANLN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-TRAP/CD40L/CD40LG Antibody Picoband®, PE Conjugate
A01114-4-PE 100 µg/Vial

Anti-TRAP/CD40L/CD40LG Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details