Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor delta variable 3 (TRDV3), Biotinylated

This Recombinant Human T cell receptor delta variable 3 (TRDV3), Biotinylated spans the amino acid sequence from region 19-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor delta variable 3 TRDV3 hDV103S1

UniProt

A0JD37

Expression Region

19-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPDYSFQFVFYGDNSRSEGADFTQGRFSVKHILTQKAFHLVISPVRTEDSATYYCAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGM2 (Transglutaminase 2 (C Polypeptide, Protein-Glutamine-gamma-glutamyltransferase), G-ALPHA-h, GNAH, TG2, TGC) (MaxLight 490)
252617-ML490 100 µL

TGM2 (Transglutaminase 2 (C Polypeptide, Protein-Glutamine-gamma-glutamyltransferase), G-ALPHA-h, GNAH, TG2, TGC) (MaxLight 490)

Sign In for Pricing
View Details
Rat COLEC12 Baculovirus-Insect cells Overexpression Lysate
MBS8117615-01 0.3 mg

Rat COLEC12 Baculovirus-Insect cells Overexpression Lysate

Sign In for Pricing
View Details
Rat COLEC12 Baculovirus-Insect cells Overexpression Lysate
MBS8117615-02 5x 0.3 mg

Rat COLEC12 Baculovirus-Insect cells Overexpression Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal Scn2b Antibody [DyLight 755]
NBP3-00207IR 0.1 mL

Rabbit Polyclonal Scn2b Antibody [DyLight 755]

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to SHC-Transforming Protein 1 (SHC1)
MBS2074961-01 0.1 mL

APC-Linked Polyclonal Antibody to SHC-Transforming Protein 1 (SHC1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to SHC-Transforming Protein 1 (SHC1)
MBS2074961-02 0.2 mL

APC-Linked Polyclonal Antibody to SHC-Transforming Protein 1 (SHC1)

Sign In for Pricing
View Details