Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor delta variable 3 (TRDV3), Biotinylated

This Recombinant Human T cell receptor delta variable 3 (TRDV3), Biotinylated spans the amino acid sequence from region 19-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor delta variable 3 TRDV3 hDV103S1

UniProt

A0JD37

Expression Region

19-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPDYSFQFVFYGDNSRSEGADFTQGRFSVKHILTQKAFHLVISPVRTEDSATYYCAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adamantane-1,3-diyldimethanamine dihydrochloride
OR1068737-01 250 mg

Adamantane-1,3-diyldimethanamine dihydrochloride

Sign In for Pricing
View Details
Adamantane-1,3-diyldimethanamine dihydrochloride
OR1068737-02 1 g

Adamantane-1,3-diyldimethanamine dihydrochloride

Sign In for Pricing
View Details
Adamantane-1,3-diyldimethanamine dihydrochloride
OR1068737-03 5 g

Adamantane-1,3-diyldimethanamine dihydrochloride

Sign In for Pricing
View Details
MLXIPL Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
30218064 1.0 µg DNA

MLXIPL Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
2-Hydroxypyrimidine HCl
FH30092 1000 g

2-Hydroxypyrimidine HCl

Sign In for Pricing
View Details
5- (4-Phenyl-4H-1,2,4-triazol-3-yl) pyridin-2-amine
YGC03383-01 50 mg

5- (4-Phenyl-4H-1,2,4-triazol-3-yl) pyridin-2-amine

Sign In for Pricing
View Details