Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NBPF family member NBPF26 (NBPFP), partial, Biotinylated

This Recombinant Human NBPF family member NBPF26 (NBPFP), partial, Biotinylated spans the amino acid sequence from region 1575-1673. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NBPF family member NBPF26; Neuroblastoma breakpoint family member 26; NBPF26

UniProt

B4DH59

Expression Region

1575-1673

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ERRRGRKEGEEDQNPPCPRLNSMLMEVEEPEVLQDSLDICYSTPSMYFELPDSFQHYRSVFYSFEEEHISFALYVDNRFFTLTVTSLHLVFQMGVIFPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apc5 (ANAPC5) Rabbit Polyclonal Antibody
TA363661 100 µL

Apc5 (ANAPC5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human PCDHGC5 activation kit by CRISPRa
GA111095 1 Kit

Human PCDHGC5 activation kit by CRISPRa

Sign In for Pricing
View Details
WLS Mouse Monoclonal Antibody [A7C2]
HA600060 100 µL

WLS Mouse Monoclonal Antibody [A7C2]

Sign In for Pricing
View Details
4-Chlorobutyraldehyde Diethyl Acetal
TRC-C365051-500MG 500 mg

4-Chlorobutyraldehyde Diethyl Acetal

Sign In for Pricing
View Details
Phospho-VASP (S156) Recombinant Rabbit Monoclonal Antibody [JE45-91]
HA722145 100 µL

Phospho-VASP (S156) Recombinant Rabbit Monoclonal Antibody [JE45-91]

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS802974 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details