Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HOXB-AS3 peptide (HAS3P), Biotinylated

This Recombinant Human HOXB-AS3 peptide (HAS3P), Biotinylated spans the amino acid sequence from region 1-53. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HOXB-AS3 peptide HOXB-AS3

UniProt

C0HLZ6

Expression Region

1-53

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPVLPGTQRYPHQRRRFQAAGGGAESGKRGSEEAPGVAWSGSESGRDAATPAW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALOX15 (Arachidonate 15-lipoxygenase, 15-LOX, Arachidonate omega-6 Lipoxygenase, LOG15) (HRP)
123247-HRP 100 µL

ALOX15 (Arachidonate 15-lipoxygenase, 15-LOX, Arachidonate omega-6 Lipoxygenase, LOG15) (HRP)

Sign In for Pricing
View Details
GRIN2B Rabbit pAb
A0890 100 µL

GRIN2B Rabbit pAb

Sign In for Pricing
View Details
PSD3 (NM_206909) Human Recombinant Protein
TP320354M 100 µg

PSD3 (NM_206909) Human Recombinant Protein

Sign In for Pricing
View Details
CSPS (SULT1A3) Mouse Monoclonal Antibody [Clone ID: OTI1E8]
CF811127 100 µg

CSPS (SULT1A3) Mouse Monoclonal Antibody [Clone ID: OTI1E8]

Sign In for Pricing
View Details
GLI2 Recombinant Protein (Human)
OPCA04404-1MG 1 mg

GLI2 Recombinant Protein (Human)

Sign In for Pricing
View Details
Citrate synthetase Polyclonal Antibody, Cy3 Conjugated
bs-17709R-Cy3 100 µL

Citrate synthetase Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details