Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative RNA-binding regulatory peptide (RBRP), Biotinylated

This Recombinant Human Putative RNA-binding regulatory peptide (RBRP), Biotinylated spans the amino acid sequence from region 1-71. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative RNA-binding regulatory peptide; RBRP; Septin 14 pseudogene 20; SEPTIN14P20 C20orf69 LINC00266-1

UniProt

C0HM01

Expression Region

1-71

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MIQQEEIRKLEEEKKQLEGEIIDFYKMKAASEALQTQLSTDTKKDKHPDPYEFLLLRKIKHPGFNEELSPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cholecystokinin (CCK) ELISA Kit
NSL1621m 96 Tests

Mouse Cholecystokinin (CCK) ELISA Kit

Sign In for Pricing
View Details
DUS2L polyclonal antibody
BS61523 50ul

DUS2L polyclonal antibody

Sign In for Pricing
View Details
PNMA1 Blocking Peptide
33R-5249 100 ug

PNMA1 Blocking Peptide

Sign In for Pricing
View Details
Polyclonal Antibody to Creatine Kinase, Mitochondrial 1A (CKMT1A)
TRV-0056004-01 20 µL

Polyclonal Antibody to Creatine Kinase, Mitochondrial 1A (CKMT1A)

Sign In for Pricing
View Details
Polyclonal Antibody to Creatine Kinase, Mitochondrial 1A (CKMT1A)
TRV-0056004-02 100 µL

Polyclonal Antibody to Creatine Kinase, Mitochondrial 1A (CKMT1A)

Sign In for Pricing
View Details
Polyclonal Antibody to Creatine Kinase, Mitochondrial 1A (CKMT1A)
TRV-0056004-03 200 µL

Polyclonal Antibody to Creatine Kinase, Mitochondrial 1A (CKMT1A)

Sign In for Pricing
View Details