Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SLC35A4 upstream open reading frame protein (S35U4), partial, Biotinylated

This Recombinant Human SLC35A4 upstream open reading frame protein (S35U4), partial, Biotinylated spans the amino acid sequence from region 1-61. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SLC35A4 upstream open reading frame protein; SLC35A4 microprotein; SLC35A4-MP; SLC35A4

UniProt

L0R6Q1

Expression Region

1-61

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MADDKDSLPKLKDLAFLKNQLESLQRRVEDEVNSGVGQDGSLLSSPFLKGFLAGYVVAKLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saccharophagus degradans ATP synthase subunit a (atpB), partial
MBS7075752 Inquire

Recombinant Saccharophagus degradans ATP synthase subunit a (atpB), partial

Sign In for Pricing
View Details
Mouse Monoclonal ErbB2/Her2 Antibody (HRB2/282) [DyLight 680]
NBP2-34642FR 0.1 mL

Mouse Monoclonal ErbB2/Her2 Antibody (HRB2/282) [DyLight 680]

Sign In for Pricing
View Details
TRA2A Antibody
E38PA3407 100 µL

TRA2A Antibody

Sign In for Pricing
View Details
5HT7 Receptor Rabbit mAb
E60M3485 100 µL

5HT7 Receptor Rabbit mAb

Sign In for Pricing
View Details
NPRL3 Rabbit Polyclonal Antibody (BF750)
orb2470545 100 µL

NPRL3 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Endoplasmic Reticulum Aminopeptidase 1 (ARTS1) Antibody
abx033722-01 80 µL

Endoplasmic Reticulum Aminopeptidase 1 (ARTS1) Antibody

Sign In for Pricing
View Details