Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial pyruvate carrier 1-like protein (MPC1L), partial, Biotinylated

This Recombinant Human Mitochondrial pyruvate carrier 1-like protein (MPC1L), partial, Biotinylated spans the amino acid sequence from region 75-136. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mitochondrial pyruvate carrier 1-like protein MPC1L

UniProt

P0DKB6

Expression Region

75-136

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VQPRNLLLMACHCTNVMAQSVQASRYLLYYYGGGGAEAKARDPPATAAAATSPGSQPPKQAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella Flexneri yebY Protein (aa 21-113)
VAng-Lsx08362-1mgEcoli 1 mg (E. coli)

Recombinant Shigella Flexneri yebY Protein (aa 21-113)

Sign In for Pricing
View Details
ST8Sia V shRNA Plasmid (h)
sc-76581-SH 20 µg

ST8Sia V shRNA Plasmid (h)

Sign In for Pricing
View Details
Rabbit Monoclonal Complement Factor H-related 2/CFHR2/CFHL2 Antibody (005) [Alexa Fluor 594]
NBP2-90262AF594 0.1 mL

Rabbit Monoclonal Complement Factor H-related 2/CFHR2/CFHL2 Antibody (005) [Alexa Fluor 594]

Sign In for Pricing
View Details
Anti-SLFN12 Antibody
MBS8323359-01 0.03 mL

Anti-SLFN12 Antibody

Sign In for Pricing
View Details
Anti-SLFN12 Antibody
MBS8323359-02 0.05 mL

Anti-SLFN12 Antibody

Sign In for Pricing
View Details
Anti-SLFN12 Antibody
MBS8323359-03 0.1 mL

Anti-SLFN12 Antibody

Sign In for Pricing
View Details