Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda-1 light chain (IGL1), Biotinylated

This Recombinant Human Immunoglobulin lambda-1 light chain (IGL1), Biotinylated spans the amino acid sequence from region 1-216. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda-1 light chain; Immunoglobulin lambda-1 light chain MCG

UniProt

P0DOX8

Expression Region

1-216

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APOBEC4 siRNA (Human)
CRJ8178-01 15 nmol

APOBEC4 siRNA (Human)

Sign In for Pricing
View Details
APOBEC4 siRNA (Human)
CRJ8178-02 30 nmol

APOBEC4 siRNA (Human)

Sign In for Pricing
View Details
Human IL-2 Quantikine HS ELISA Kit
HS200 96 Tests

Human IL-2 Quantikine HS ELISA Kit

Sign In for Pricing
View Details
Sumo 2/3 Antibody, mAb, Rabbit
A03343-50 50 µL

Sumo 2/3 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
DLX1 (NM_001038493) Human Tagged ORF Clone
RC208797 10 µg

DLX1 (NM_001038493) Human Tagged ORF Clone

Sign In for Pricing
View Details
TOM1 Polyclonal Conjugated Antibody
orb1625483 100 µL

TOM1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details