Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-8 (HV108), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 1-8 (HV108), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-8 IGHV1-8

UniProt

P0DP01

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYDINWVRQATGQGLEWMGWMNPNSGNTGYAQKFQGRVTMTRNTSISTAYMELSSLRSEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PC1/3 (PCSK1) (652-754) Mouse Monoclonal Antibody [Clone ID: 3D2]
AM31061PU-N 50 µg

PC1/3 (PCSK1) (652-754) Mouse Monoclonal Antibody [Clone ID: 3D2]

Sign In for Pricing
View Details
Ampd2 Mouse Gene Knockout Kit (CRISPR)
KN501205 1 Kit

Ampd2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FSIP1 Mouse Monoclonal Antibody [Clone ID: OTI5E10]
CF806143 100 µg

FSIP1 Mouse Monoclonal Antibody [Clone ID: OTI5E10]

Sign In for Pricing
View Details
N-Nitroso Delapril
TRC-D459933-10MG 10 mg

N-Nitroso Delapril

Sign In for Pricing
View Details
Human CAPS1 (CADPS) activation kit by CRISPRa
GA105705 1 Kit

Human CAPS1 (CADPS) activation kit by CRISPRa

Sign In for Pricing
View Details
Electric OR table BOPT-105
BOPT-105 1 Unit

Electric OR table BOPT-105

Sign In for Pricing
View Details