Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-8 (HV108), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 1-8 (HV108), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-8 IGHV1-8

UniProt

P0DP01

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYDINWVRQATGQGLEWMGWMNPNSGNTGYAQKFQGRVTMTRNTSISTAYMELSSLRSEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HYAL6P Human qPCR Primer Pair (NR_002731)
HP220116 200 Reactions

HYAL6P Human qPCR Primer Pair (NR_002731)

Sign In for Pricing
View Details
ERK1 (MAPK3) (NM_001109891) Human Over-expression Lysate
LY426307 100 µg

ERK1 (MAPK3) (NM_001109891) Human Over-expression Lysate

Sign In for Pricing
View Details
TMEM184A Rabbit polyclonal Antibody
HA500595 100 µL

TMEM184A Rabbit polyclonal Antibody

Sign In for Pricing
View Details
PIP5K3 (PIKFYVE) Mouse Monoclonal Antibody [Clone ID: OTI1A5]
CF810375 100 µg

PIP5K3 (PIKFYVE) Mouse Monoclonal Antibody [Clone ID: OTI1A5]

Sign In for Pricing
View Details
Protein A/G PCR Plates - skirted
PCR960308-PA/G 10 Plates

Protein A/G PCR Plates - skirted

Sign In for Pricing
View Details
PWWP domain containing protein 2B (PWWP2B) (NM_001098637) Human Over-expression Lysate
LY420659 100 µg

PWWP domain containing protein 2B (PWWP2B) (NM_001098637) Human Over-expression Lysate

Sign In for Pricing
View Details