Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-30-3 (HVC33), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-30-3 (HVC33), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-30-3 IGHV3-30-3

UniProt

P0DP02

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

11 (S) -Hydroxy-7 (Z),9 (E),13 (Z) -hexadecatrienoic acid
HY-165716 1 Each

11 (S) -Hydroxy-7 (Z),9 (E),13 (Z) -hexadecatrienoic acid

Sign In for Pricing
View Details
TMEM167B siRNA (Human)
CRJ1206-01 15 nmol

TMEM167B siRNA (Human)

Sign In for Pricing
View Details
TMEM167B siRNA (Human)
CRJ1206-02 30 nmol

TMEM167B siRNA (Human)

Sign In for Pricing
View Details
Keratin, type II cytoskeletal 7
orb1645455-01 50 µg

Keratin, type II cytoskeletal 7

Sign In for Pricing
View Details
Keratin, type II cytoskeletal 7
orb1645455-02 100 µg

Keratin, type II cytoskeletal 7

Sign In for Pricing
View Details
Keratin, type II cytoskeletal 7
orb1645455-03 1 mg

Keratin, type II cytoskeletal 7

Sign In for Pricing
View Details