Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-43D (HV43D), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-43D (HV43D), Biotinylated spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-43D IGHV3-43D

UniProt

P0DP04

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGVVVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSLISWDGGSTYYADSVKGRFTISRDNSKNSLYLQMNSLRAEDTALYYCAKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBP1 (Retinol-Binding Protein 1, Retinol Binding Protein 1, Cellular)
490264 100 µL

RBP1 (Retinol-Binding Protein 1, Retinol Binding Protein 1, Cellular)

Sign In for Pricing
View Details
XRRA1 (NM_001270380) Human Tagged ORF Clone
RC233000 10 µg

XRRA1 (NM_001270380) Human Tagged ORF Clone

Sign In for Pricing
View Details
PFDN5 Human Recombinant Protein
TP724940 50 µg

PFDN5 Human Recombinant Protein

Sign In for Pricing
View Details
IL10 ELISA Kit (Chicken) (OKAN06095)
OKAN06095 96 Well

IL10 ELISA Kit (Chicken) (OKAN06095)

Sign In for Pricing
View Details
Donkey V-Type Proton ATPase Subunit D2 (ATP6V0D2) ELISA Kit
MBS9395241 Inquire

Donkey V-Type Proton ATPase Subunit D2 (ATP6V0D2) ELISA Kit

Sign In for Pricing
View Details
CHRFAM7A antibody - middle region (ARP35408_P050)
ARP35408_P050 100 µL

CHRFAM7A antibody - middle region (ARP35408_P050)

Sign In for Pricing
View Details