Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-31 (HV431), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-31 (HV431), Biotinylated spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-31 IGHV4-31

UniProt

P0DP07

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGYYWSWIRQHPGKGLEWIGYIYYSGSTYYNPSLKSLVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SBDS sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2091208 1.0 µg DNA

SBDS sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit Polyclonal Guanylate kinase Antibody [mFluor Violet 610 SE]
NBP2-97222MFV610 0.1 mL

Rabbit Polyclonal Guanylate kinase Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
NPTX2 Polyclonal Antibody, APC-Cy7 Conjugated
bs-11017R-APC-Cy7 100 µL

NPTX2 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Collagen Type IV (Arresten, ASLN, ATS, CA54, Canstatin, COL4A1, COL4A2, Collagen Alpha 1 (IV) Chain, Collagen Alpha 2 (IV) Chain, Collagen IV Alpha 1 Polypeptide, Collagen IV Alpha 2 Polypeptide, Collagen of Basement Membrane Alpha 1 Chain, Collagen of Basement Membrane Alpha 2 Chain, Collagen Type IV Alpha 1, Collagen Type IV Alpha 2, DKFZp686I14213, FLJ22259, Goodpasture antigen)
C7510-51 100 µL

Collagen Type IV (Arresten, ASLN, ATS, CA54, Canstatin, COL4A1, COL4A2, Collagen Alpha 1 (IV) Chain, Collagen Alpha 2 (IV) Chain, Collagen IV Alpha 1 Polypeptide, Collagen IV Alpha 2 Polypeptide, Collagen of Basement Membrane Alpha 1 Chain, Collagen of Basement Membrane Alpha 2 Chain, Collagen Type IV Alpha 1, Collagen Type IV Alpha 2, DKFZp686I14213, FLJ22259, Goodpasture antigen)

Sign In for Pricing
View Details
UGT71D2 Antibody
orb798228 2 mg

UGT71D2 Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal Meprin alpha Subunit/MEP1A Antibody (009) [mFluor Violet 610 SE]
NBP2-89287MFV610 0.1 mL

Rabbit Monoclonal Meprin alpha Subunit/MEP1A Antibody (009) [mFluor Violet 610 SE]

Sign In for Pricing
View Details