Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-31 (HV431), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-31 (HV431), Biotinylated spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-31 IGHV4-31

UniProt

P0DP07

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGYYWSWIRQHPGKGLEWIGYIYYSGSTYYNPSLKSLVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FK506 Binding Protein 4 (FKBP4) ELISA Kit
EKU04232 96 Tests

Human FK506 Binding Protein 4 (FKBP4) ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) SAAL1 Polyclonal Antibody
MBS9000484 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) SAAL1 Polyclonal Antibody

Sign In for Pricing
View Details
PVRL2 discontinued
393554 200 µL

PVRL2 discontinued

Sign In for Pricing
View Details
GM2A (NM_001167607) Human Tagged ORF Clone Lentiviral Particle
RC229647L3V 200 µL

GM2A (NM_001167607) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
OR2F2, CT (OR2F2, Olfactory receptor 2F2, Olfactory receptor 7-1, Olfactory receptor OR7-6) (FITC) discontinued
039354-FITC 200 µL

OR2F2, CT (OR2F2, Olfactory receptor 2F2, Olfactory receptor 7-1, Olfactory receptor OR7-6) (FITC) discontinued

Sign In for Pricing
View Details
PSGL-1/Selplg/PSGL Rabbit Polyclonal Antibody (PE)
orb2606184 100 µg

PSGL-1/Selplg/PSGL Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details