Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-31 (HV431), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-31 (HV431), Biotinylated spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-31 IGHV4-31

UniProt

P0DP07

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGYYWSWIRQHPGKGLEWIGYIYYSGSTYYNPSLKSLVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat LRRC46 shRNA Plasmid
abx988262-01 150 µg

Rat LRRC46 shRNA Plasmid

Sign In for Pricing
View Details
Rat LRRC46 shRNA Plasmid
abx988262-02 300 µg

Rat LRRC46 shRNA Plasmid

Sign In for Pricing
View Details
NEU3 Knockout AGS Polyclonal Cells
ARG2421 1 Million

NEU3 Knockout AGS Polyclonal Cells

Sign In for Pricing
View Details
FNTBL1 sgRNA CRISPR Lentivector set (Human)
K0793201 3x 1.0 µg

FNTBL1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
COMMD6 Rabbit Polyclonal Antibody
E28PT8071 100 µL

COMMD6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Grid2ip (BC075624) Mouse Tagged ORF Clone Lentiviral Particle
MR211484L3V 200 µL

Grid2ip (BC075624) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details