Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-31 (HV431), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-31 (HV431), Biotinylated spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-31 IGHV4-31

UniProt

P0DP07

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGYYWSWIRQHPGKGLEWIGYIYYSGSTYYNPSLKSLVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (Benzyloxycarbonylamino) -4-fluorophenylboronic acid
423080-01 100 mg

3- (Benzyloxycarbonylamino) -4-fluorophenylboronic acid

Sign In for Pricing
View Details
3- (Benzyloxycarbonylamino) -4-fluorophenylboronic acid
423080-02 250 mg

3- (Benzyloxycarbonylamino) -4-fluorophenylboronic acid

Sign In for Pricing
View Details
TRIML1 (Probable E3 Ubiquitin-protein Ligase TRIML1, RING Finger Protein 209, Tripartite Motif Family-like Protein 1, RNF209, FLJ36180, MGC138638, MGC138639) (MaxLight 550)
134774-ML550 100 µL

TRIML1 (Probable E3 Ubiquitin-protein Ligase TRIML1, RING Finger Protein 209, Tripartite Motif Family-like Protein 1, RNF209, FLJ36180, MGC138638, MGC138639) (MaxLight 550)

Sign In for Pricing
View Details
Microcephalin siRNA (m)
sc-61043 10 µM

Microcephalin siRNA (m)

Sign In for Pricing
View Details
ADRB2 antibody
38345-01 50 µL

ADRB2 antibody

Sign In for Pricing
View Details
ADRB2 antibody
38345-02 100 µL

ADRB2 antibody

Sign In for Pricing
View Details