Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-38-2 (HVD82), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-38-2 (HVD82), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-38-2 IGHV4-38-2

UniProt

P0DP08

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSETLSLTCTVSGYSISSGYYWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat MMP-9 Antibody Pair Set
E-KAB-0108 50 µL & 100 µg

Rat MMP-9 Antibody Pair Set

Sign In for Pricing
View Details
4-(2-Pyridinyl)-2-pyrimidinamine
TRC-P991695-250MG 250 mg

4-(2-Pyridinyl)-2-pyrimidinamine

Sign In for Pricing
View Details
Ketosamine 3 kinase (FN3KRP) (NM_024619) Human Recombinant Protein
TP303554M 100 µg

Ketosamine 3 kinase (FN3KRP) (NM_024619) Human Recombinant Protein

Sign In for Pricing
View Details
Human IFN-gamma R1, C-His Tag (ECD)
HA210514-01 20 µg

Human IFN-gamma R1, C-His Tag (ECD)

Sign In for Pricing
View Details
Human IFN-gamma R1, C-His Tag (ECD)
HA210514-02 50 µg

Human IFN-gamma R1, C-His Tag (ECD)

Sign In for Pricing
View Details
Human IFN-gamma R1, C-His Tag (ECD)
HA210514-03 100 µg

Human IFN-gamma R1, C-His Tag (ECD)

Sign In for Pricing
View Details