Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-38-2 (HVD82), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-38-2 (HVD82), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-38-2 IGHV4-38-2

UniProt

P0DP08

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSETLSLTCTVSGYSISSGYYWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TOPBP1, C-His Tag
HA210666-01 20 µg

Human TOPBP1, C-His Tag

Sign In for Pricing
View Details
Human TOPBP1, C-His Tag
HA210666-02 50 µg

Human TOPBP1, C-His Tag

Sign In for Pricing
View Details
Human TOPBP1, C-His Tag
HA210666-03 100 µg

Human TOPBP1, C-His Tag

Sign In for Pricing
View Details
Cytochrome P450 Reductase (POR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F10]
TA500633AM 100 µL

Cytochrome P450 Reductase (POR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F10]

Sign In for Pricing
View Details
Ethyl Lauroyl Arginate-d23 Hydrochloride
TRC-E921957-1MG 1 mg

Ethyl Lauroyl Arginate-d23 Hydrochloride

Sign In for Pricing
View Details
Gliclazide Impurity D
TRC-G409885-25MG 25 mg

Gliclazide Impurity D

Sign In for Pricing
View Details