Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-38-2 (HVD82), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-38-2 (HVD82), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-38-2 IGHV4-38-2

UniProt

P0DP08

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSETLSLTCTVSGYSISSGYYWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Pleura
CB501798 1 Block

Frozen Tissue Blocks, Pleura

Sign In for Pricing
View Details
beta Catenin (CTNNB1) pThr41/pSer45 Rabbit Polyclonal Antibody
AP02406PU-N 100 µL

beta Catenin (CTNNB1) pThr41/pSer45 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CK8
Y123136 100 µL

Anti-CK8

Sign In for Pricing
View Details
MOG Antibody
KC-973-01 50 μL

MOG Antibody

Sign In for Pricing
View Details
MOG Antibody
KC-973-02 100 µL

MOG Antibody

Sign In for Pricing
View Details
MOG Antibody
KC-973-03 1 mL

MOG Antibody

Sign In for Pricing
View Details