Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-38-2 (HVD82), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-38-2 (HVD82), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-38-2 IGHV4-38-2

UniProt

P0DP08

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSETLSLTCTVSGYSISSGYYWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RPUSD2 Protein
E30P65025D 50 µg

Recombinant Human RPUSD2 Protein

Sign In for Pricing
View Details
H-DRV^^YIHP^^F^^HL-OH
PP49760 1 mg

H-DRV^^YIHP^^F^^HL-OH

Sign In for Pricing
View Details
FAM76A 3'UTR Luciferase Stable Cell Line
TU007409 1.0 mL

FAM76A 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ACACA, CT (ACACA, ACAC, ACC1, ACCA, Acetyl-CoA carboxylase 1, ACC-alpha, Biotin carboxylase) (MaxLight 490)
MBS6270755-01 0.1 mL

ACACA, CT (ACACA, ACAC, ACC1, ACCA, Acetyl-CoA carboxylase 1, ACC-alpha, Biotin carboxylase) (MaxLight 490)

Sign In for Pricing
View Details
ACACA, CT (ACACA, ACAC, ACC1, ACCA, Acetyl-CoA carboxylase 1, ACC-alpha, Biotin carboxylase) (MaxLight 490)
MBS6270755-02 5x 0.1 mL

ACACA, CT (ACACA, ACAC, ACC1, ACCA, Acetyl-CoA carboxylase 1, ACC-alpha, Biotin carboxylase) (MaxLight 490)

Sign In for Pricing
View Details
Rabbit Anti S100A4 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,IHC,Immunofluorescence)
IRBAMLS100A4AP385120UL 1 Each

Rabbit Anti S100A4 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,IHC,Immunofluorescence)

Sign In for Pricing
View Details