Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human V-set and immunoglobulin domain-containing protein 10-like 2 (VSXL2), partial, Biotinylated

This Recombinant Human V-set and immunoglobulin domain-containing protein 10-like 2 (VSXL2), partial, Biotinylated spans the amino acid sequence from region 29-703. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

V-set and immunoglobulin domain-containing protein 10-like 2 VSIG10L2

UniProt

P0DP72

Expression Region

29-703

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPHPTPEAPVEEVVSVQGVRGGSVELACGSGPAPLLVLWSFTPLGSLVPRPVAVTDGAMSKVEAIASALGVVSLRNSSLVLGELHEGARGHFLCQVLHVAGGQLHAAYSHLTLAVLVPVSKPQVRLSNPSPVEGASVVATCAVREGTEPVTFAWQHRAPRGLGEALVGVTEPLFQLDPVNRTHLGWYMCSASNSVNRLSSDGAFLDVIYGPDKPVITMEPLGLTEEGFWASEREEVTLSCLAASNPPSHYVWLRDHTQVHTGPTYVIARAGRVHTGLYTCLARNSYLDTRTQTTVQLTIYYPPEGQPSCAVHPSPEAVTLLCAWPGGLPPAQLQWEGPQGPGPTAPSNVTWSHAAAQLPSGSVFTCTGQHPALAPPALCTVMLWEPLGRPTCWSTATMGDQFIMLSCEWPGGEPPATLGWLDEQQQPLGGSSSSMAVHLLQAQEDLAGREFTCRGTHLLRTPDPHCHLQLEAPQLDVAEPRVSVLEGGEAWLECSLRGGTPPAQLLWLGPQQQKVDPGTSGFMLHPEGAQLRLGIYDADPAHHRGTYQCVARNAVGNSSQSVLLEVLRYPAPPNVTISRLTYGRHRREVQLQWAILGPGNLTGFLVQRKASALGPGAGAWETAASDIEPESRGRRLGGLDPGVLYAFRILALNHHTAGHPSEVKIPADPPFSAYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF488A conjugate, 0.1mg/mL
BNC880871-100 1x 100 µL

CD71 (66IG10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF488A conjugate, 0.1mg/mL
BNC880449-500 1x 500 µL

CD104 (UM-A9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
BNC681820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF568 conjugate, 0.1mg/mL
BNC681052-500 1x 500 µL

CD3e (B-B12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL
BNC470437-500 1x 500 µL

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details