Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 130B (D130B), Biotinylated

This Recombinant Human Beta-defensin 130B (D130B), Biotinylated spans the amino acid sequence from region 23-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 130B DEFB130B

UniProt

P0DP73

Expression Region

23-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Involucrin (IVRN/827), CF488A conjugate, 0.1mg/mL
BNC880827-500 1x 500 µL

Involucrin (IVRN/827), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
5-(3-Chloropropyl)-5H-dibenzo[b,f]azepine
TRC-C366845-1G 1 g

5-(3-Chloropropyl)-5H-dibenzo[b,f]azepine

Sign In for Pricing
View Details
NUMB (NM_001005744) Human Over-expression Lysate
LC423644 20 µg

NUMB (NM_001005744) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometriotic tissue
CS708200 5x 5 µm

Tissue FFPE Sections, Endometriotic tissue

Sign In for Pricing
View Details
UHRF2 Polyclonal Antibody
E-AB-64743-01 60 µL

UHRF2 Polyclonal Antibody

Sign In for Pricing
View Details
UHRF2 Polyclonal Antibody
E-AB-64743-02 120 µL

UHRF2 Polyclonal Antibody

Sign In for Pricing
View Details