Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 130B (D130B), Biotinylated

This Recombinant Human Beta-defensin 130B (D130B), Biotinylated spans the amino acid sequence from region 23-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 130B DEFB130B

UniProt

P0DP73

Expression Region

23-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOB3B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV643144 1.0 µg DNA

MOB3B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
COMP, ID (Cartilage Oligomeric Matrix Protein, Thrombospondin-5, TSP5) (MaxLight 750) discontinued
C7849-09E-ML750 100 µL

COMP, ID (Cartilage Oligomeric Matrix Protein, Thrombospondin-5, TSP5) (MaxLight 750) discontinued

Sign In for Pricing
View Details
pCMV-SPORT6-CCK Plasmid
PVT35236 2 µg

pCMV-SPORT6-CCK Plasmid

Sign In for Pricing
View Details
Rabbit anti-MKK1/2 Antibody
MBS4513607-01 0.05 mL

Rabbit anti-MKK1/2 Antibody

Sign In for Pricing
View Details
Rabbit anti-MKK1/2 Antibody
MBS4513607-02 0.1 mL

Rabbit anti-MKK1/2 Antibody

Sign In for Pricing
View Details
Rabbit anti-MKK1/2 Antibody
MBS4513607-03 5x 0.1 mL

Rabbit anti-MKK1/2 Antibody

Sign In for Pricing
View Details