Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 130B (D130B), Biotinylated

This Recombinant Human Beta-defensin 130B (D130B), Biotinylated spans the amino acid sequence from region 23-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 130B DEFB130B

UniProt

P0DP73

Expression Region

23-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD220/INSR Protein, N-His
orb2969479-01 50 µg

Recombinant Human CD220/INSR Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD220/INSR Protein, N-His
orb2969479-02 100 µg

Recombinant Human CD220/INSR Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD220/INSR Protein, N-His
orb2969479-03 1 mg

Recombinant Human CD220/INSR Protein, N-His

Sign In for Pricing
View Details
4- (1,4'-bipiperidin-1'-yl) -3-[ (4-fluorophenyl) sulfonyl]quinoline-7-carbonitrile
sc-492782 5 mg

4- (1,4'-bipiperidin-1'-yl) -3-[ (4-fluorophenyl) sulfonyl]quinoline-7-carbonitrile

Sign In for Pricing
View Details
OSBL6 Polyclonal Antibody
E11-201020 100 µg -100 µL

OSBL6 Polyclonal Antibody

Sign In for Pricing
View Details
Cygb (NM_130744) Rat Tagged ORF Clone
RR202337 10 µg

Cygb (NM_130744) Rat Tagged ORF Clone

Sign In for Pricing
View Details