Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 130A (D130A), Biotinylated

This Recombinant Human Beta-defensin 130A (D130A), Biotinylated spans the amino acid sequence from region 23-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 130A; Beta-defensin 130; Beta-defensin 30; DEFB-30; Defensin, beta 130; DEFB130A DEFB130 DEFB30

UniProt

P0DP74

Expression Region

23-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL
BNC940266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF405S conjugate, 0.1mg/mL
BNC040871-500 1x 500 µL

CD71 (66IG10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF568 conjugate, 0.1mg/mL
BNC681786-500 1x 500 µL

P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (B-Cell Marker) (PTPRC/2877R), CF594 conjugate, 0.1mg/mL
BNC942877-500 1x 500 µL

CD45RB (B-Cell Marker) (PTPRC/2877R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) (ADFP/2755R), CF568 conjugate, 0.1mg/mL
BNC682755-500 1x 500 µL

Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) (ADFP/2755R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (BP53-12), CF740 conjugate, 0.1mg/mL
BNC740013-100 1x 100 µL

P53 (BP53-12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details