Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 130A (D130A), Biotinylated

This Recombinant Human Beta-defensin 130A (D130A), Biotinylated spans the amino acid sequence from region 23-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 130A; Beta-defensin 130; Beta-defensin 30; DEFB-30; Defensin, beta 130; DEFB130A DEFB130 DEFB30

UniProt

P0DP74

Expression Region

23-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal PKM2 Antibody (1B10) [DyLight 350]
NBP2-42686UV 100 µL

Mouse Monoclonal PKM2 Antibody (1B10) [DyLight 350]

Sign In for Pricing
View Details
ASPHD1 Antibody; Biotin conjugated
MBS7004290-01 0.05 mg

ASPHD1 Antibody; Biotin conjugated

Sign In for Pricing
View Details
ASPHD1 Antibody; Biotin conjugated
MBS7004290-02 0.1 mg

ASPHD1 Antibody; Biotin conjugated

Sign In for Pricing
View Details
ASPHD1 Antibody; Biotin conjugated
MBS7004290-03 5x 0.1 mg

ASPHD1 Antibody; Biotin conjugated

Sign In for Pricing
View Details
Tbc1d10a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7432105 3x 1.0 µg

Tbc1d10a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Anti-Human CD131/CSF2RB Antibody (SAA1389), APC
FHE01523 100 Tests

Anti-Human CD131/CSF2RB Antibody (SAA1389), APC

Sign In for Pricing
View Details