Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein POLR1D, isoform 2 (RPC22), Biotinylated

This Recombinant Human Protein POLR1D, isoform 2 (RPC22), Biotinylated spans the amino acid sequence from region 1-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein POLR1D, isoform 2 POLR1D

UniProt

P0DPB5

Expression Region

1-122

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 488 Anti-Human CD44 Antibody[HI313]
E-AB-F1329L-01 20 Tests

Elab Fluor® 488 Anti-Human CD44 Antibody[HI313]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD44 Antibody[HI313]
E-AB-F1329L-02 100 Tests

Elab Fluor® 488 Anti-Human CD44 Antibody[HI313]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD44 Antibody[HI313]
E-AB-F1329L-03 2x 100 Tests

Elab Fluor® 488 Anti-Human CD44 Antibody[HI313]

Sign In for Pricing
View Details
Human Retinoid X Receptor Alpha (RXRa) ELISA Kit
RD-RXRa-Hu-01 96 Tests

Human Retinoid X Receptor Alpha (RXRa) ELISA Kit

Sign In for Pricing
View Details
Human Retinoid X Receptor Alpha (RXRa) ELISA Kit
RD-RXRa-Hu-02 48 Tests

Human Retinoid X Receptor Alpha (RXRa) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS628645 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details