Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein POLR1D, isoform 2 (RPC22), Biotinylated

This Recombinant Human Protein POLR1D, isoform 2 (RPC22), Biotinylated spans the amino acid sequence from region 1-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein POLR1D, isoform 2 POLR1D

UniProt

P0DPB5

Expression Region

1-122

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAMKIV (CAMK4) (NM_001744) Human Over-expression Lysate
LY400661 100 µg

CAMKIV (CAMK4) (NM_001744) Human Over-expression Lysate

Sign In for Pricing
View Details
Osteopontin Recombinant Rabbit monoclonal Antibody
HA751506 100 µL

Osteopontin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Esophagus
CS713882 5x 5 µm

Tissue FFPE Sections, Esophagus

Sign In for Pricing
View Details
C1orf104 (RUSC1-AS1) (NM_001039517) Human Over-expression Lysate
LY422064 100 µg

C1orf104 (RUSC1-AS1) (NM_001039517) Human Over-expression Lysate

Sign In for Pricing
View Details
ADCY5 (+ADCY6) Rabbit Polyclonal Antibody
AP20397PU-N 100 µg

ADCY5 (+ADCY6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD2 (LFA2/600), CF594 conjugate, 0.1mg/mL
BNC940600-500 1x 500 µL

CD2 (LFA2/600), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details