Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein POLR1D, isoform 2 (RPC22), Biotinylated

This Recombinant Human Protein POLR1D, isoform 2 (RPC22), Biotinylated spans the amino acid sequence from region 1-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein POLR1D, isoform 2 POLR1D

UniProt

P0DPB5

Expression Region

1-122

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCPTP1 (PTPRR) (NM_130846) Human Recombinant Protein
PH36965M5 20 µg

PCPTP1 (PTPRR) (NM_130846) Human Recombinant Protein

Sign In for Pricing
View Details
Anti-Argonaute-2 Antibody, Rabbit Polyclonal
MBS8104178-01 0.1 mL

Anti-Argonaute-2 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-Argonaute-2 Antibody, Rabbit Polyclonal
MBS8104178-02 5x 0.1 mL

Anti-Argonaute-2 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
CEACAM7 Polyclonal Antibody, Biotin Conjugated
A62257-100 100 µL

CEACAM7 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
FCRL4 Peptide
orb2014459 100 µg

FCRL4 Peptide

Sign In for Pricing
View Details
PLAGL2 3'UTR GFP Stable Cell Line
TU068198 1.0 mL

PLAGL2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details