Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 35 (TVA35), Biotinylated

This Recombinant Human T cell receptor alpha variable 35 (TVA35), Biotinylated spans the amino acid sequence from region 20-110. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 35 TRAV35

UniProt

P0DPF4

Expression Region

20-110

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQLNQSPQSMFIQEGEDVSMNCTSSSIFNTWLWYKQEPGEGPVLLIALYKAGELTSNGRLTAQFGITRKDSFLNISASIPSDVGIYFCAGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP40-4 Polyclonal Antibody
E-AB-11313-01 20 µL

HSP40-4 Polyclonal Antibody

Sign In for Pricing
View Details
HSP40-4 Polyclonal Antibody
E-AB-11313-02 60 µL

HSP40-4 Polyclonal Antibody

Sign In for Pricing
View Details
HSP40-4 Polyclonal Antibody
E-AB-11313-03 120 µL

HSP40-4 Polyclonal Antibody

Sign In for Pricing
View Details
HSP40-4 Polyclonal Antibody
E-AB-11313-04 200 µL

HSP40-4 Polyclonal Antibody

Sign In for Pricing
View Details
Carbonic Anhydrase VIII (CPTC-CA8-2), CF488A conjugate, 0.1mg/mL
BNC882232-500 1x 500 µL

Carbonic Anhydrase VIII (CPTC-CA8-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PIGP Human Gene Knockout Kit (CRISPR)
KN403040 1 Kit

PIGP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details