Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-3 (TVB63), Biotinylated

This Recombinant Human T cell receptor beta variable 6-3 (TVB63), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-3 TRBV6-3

UniProt

P0DPF7

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAZ1 Antibody - N-terminal region : Biotin (ARP58711_P050-Biotin)
ARP58711_P050-Biotin 100 µL

DAZ1 Antibody - N-terminal region : Biotin (ARP58711_P050-Biotin)

Sign In for Pricing
View Details
MEX3B Protein Vector (Mouse) (pPM-C-HA)
28427024 500 ng

MEX3B Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
C7orf43-set siRNA/shRNA/RNAi Lentivector (Human)
14689091 4x 500 ng

C7orf43-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
CPSF6 Antibody, HRP conjugated
CSB-PA621966LB01HU-01 50 µg

CPSF6 Antibody, HRP conjugated

Sign In for Pricing
View Details
CPSF6 Antibody, HRP conjugated
CSB-PA621966LB01HU-02 100 µg

CPSF6 Antibody, HRP conjugated

Sign In for Pricing
View Details
Phospho-Smad1 (Ser465) Polyclonal Antibody, PE-Cy7 Conjugated
bs-10380R-PE-Cy7 100 µL

Phospho-Smad1 (Ser465) Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details