Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-3 (TVB63), Biotinylated

This Recombinant Human T cell receptor beta variable 6-3 (TVB63), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-3 TRBV6-3

UniProt

P0DPF7

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saccharomyces cerevisiae Peroxisome assembly protein 22 (PEX22)
MBS7026009-01 0.02 mg

Recombinant Saccharomyces cerevisiae Peroxisome assembly protein 22 (PEX22)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Peroxisome assembly protein 22 (PEX22)
MBS7026009-02 0.1 mg

Recombinant Saccharomyces cerevisiae Peroxisome assembly protein 22 (PEX22)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Peroxisome assembly protein 22 (PEX22)
MBS7026009-03 5x 0.1 mg

Recombinant Saccharomyces cerevisiae Peroxisome assembly protein 22 (PEX22)

Sign In for Pricing
View Details
Monoclonal RHOA Antibody (monoclonal) (M04), Clone: 1B12
AMM04009G 0.1mg

Monoclonal RHOA Antibody (monoclonal) (M04), Clone: 1B12

Sign In for Pricing
View Details
pCMV-SPORT6-Mtus1 Plasmid
PVT57239 2 µg

pCMV-SPORT6-Mtus1 Plasmid

Sign In for Pricing
View Details
Human Argonaute-2 Protein, His Tag
AR2-H5543 100 µg

Human Argonaute-2 Protein, His Tag

Sign In for Pricing
View Details