Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-3 (TVB63), Biotinylated

This Recombinant Human T cell receptor beta variable 6-3 (TVB63), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-3 TRBV6-3

UniProt

P0DPF7

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCBP4 Antibody, FITC conjugated
CSB-PA017521LC01HU-01 50 µg

PCBP4 Antibody, FITC conjugated

Sign In for Pricing
View Details
PCBP4 Antibody, FITC conjugated
CSB-PA017521LC01HU-02 100 µg

PCBP4 Antibody, FITC conjugated

Sign In for Pricing
View Details
Rat Period Circadian Protein 2 (PER2) ELISA Kit
DLR-PER2-Ra-96T 96 Tests

Rat Period Circadian Protein 2 (PER2) ELISA Kit

Sign In for Pricing
View Details
3-Bromo-2-fluoro-N- (2,2,2-trifluoroethyl) aniline
PC57096 1 Each

3-Bromo-2-fluoro-N- (2,2,2-trifluoroethyl) aniline

Sign In for Pricing
View Details
Estrogen Receptor alpha Antibody, Cy5 Conjugated
bs-0122R-Cy5 100 µL

Estrogen Receptor alpha Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
IFluor® 430 Anti-human CD16 Antibody *HI16a*
10160031-AAT 500 Tests

IFluor® 430 Anti-human CD16 Antibody *HI16a*

Sign In for Pricing
View Details