Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human DDIT3 upstream open reading frame protein (DT3UO), Biotinylated

This Recombinant Human DDIT3 upstream open reading frame protein (DT3UO), Biotinylated spans the amino acid sequence from region 1-34. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DDIT3 upstream open reading frame protein; Alternative DDIT3 protein; AltDDIT3; DDIT3

UniProt

P0DPQ6

Expression Region

1-34

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MLKMSGWQRQSQNQSWNLRRECSRRKCIFIHHHT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C19orf54 activation kit by CRISPRa
GA117121 1 Kit

Human C19orf54 activation kit by CRISPRa

Sign In for Pricing
View Details
Moesin (MSN/491), CF647 conjugate, 0.1mg/mL
BNC470491-100 1x 100 µL

Moesin (MSN/491), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS627829 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
FOXO1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C6]
TA810711BM 100 µL

FOXO1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C6]

Sign In for Pricing
View Details
MAG Recombinant Chimeric Antibody Antibody
HA610340 100 µL

MAG Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
GSTM4 Rabbit Polyclonal Antibody
TA362082 100 µL

GSTM4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details